Secteur de Zhuqiao Pudong de route de No.8 Jinshun nouveau, Changhaï, Chine
Aperçu ProduitsPeptides injectables

Peptides CJC-1295 de bâtiment de muscle sans DAC pour des Bodybuilders

Peptides CJC-1295 de bâtiment de muscle sans DAC pour des Bodybuilders

    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
  • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders

    Détails sur le produit:

    Lieu d'origine: Shanghai
    Nom de marque: FILTER
    Certification: GMP
    Numéro de modèle: API

    Conditions de paiement et expédition:

    Quantité de commande min: 10 fioles
    Prix: USD 4~8 per vial
    Détails d'emballage: 2mg, 5mg/vial, 10mg/vial ou au besoin
    Délai de livraison: Dans les 3 jours ouvrables
    Conditions de paiement: L/C, T/T, , MoneyGram, Payneer
    Capacité d'approvisionnement: 100,000VIALS/MONTH
    Description de produit détaillée
    Spécification: 2mg/vial Apparence: poudre blanche
    DeliveryTime: dans un délai de 3~7 jours ouvrables Port: Changhaï/Shenzhen Hong Kong
    Paquet: Icebag, manières discrètes d'emballage pour votre référence LimitNum: 10 fioles
    Pureté: 99% Transport: DHL, Fedix, HKEMS, HKEUB, TNT
    Stockage: endroit sec, foncé et aéré, (dogree 2~8)

    peptides bodybuilding supplements


    human growth peptides

    CJC-1295 avec DAC

    Nom de produit : CJC1295 DAC ; CJC1295 avec DAC
    Alias : CJC1295 (GHRH/DAC)
    Ordre : Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-LysLys (Maleimidopropionyl) - NH2 (complexe d'affinité)
    Densité : 1,45
    CJC-1295 avec DAC
    Type : Fonction immunisée AgentsGrade
    Norme : Catégorie de médecine
    Classification : Brassinosteroid
    MF : C165H271N47O46
    Poids moléculaire : 3649,30
    Pureté (CLHP) : 98,0%
    Aspect : Poudre blanche
    Impureté simple (CLHP) : 1,0%
    Composition en acides aminés : 10% de théorique
    Contenu de peptide (N%) : 80% (par %N)
    Teneur en eau (Karl Fischer) : 6,0%
    Contenu d'acétate (HPIC) : 15,0%
    Bilan de matière : 95.0~105.0%

    Filtre Biotech Cie., Ltd. Business Field :

    Comme peptides et stéroïdes fabricant, nous sommes pour l'OEM pour les clients qui ont des conditions de marques. (Service fait sur commande).
    Nos services de société :

    1. Peptide pharmaceutique de Peptide+Bodubuilding
    2. Peptide cosmétique
    3. Poudre, huile et étiquettes de Sterodis
    4. Service fait sur commande

    Queest-ce que dactylographie vos clients préfèrent ?


    Nom de produit : CJC1295
    Synonymes : CJC1295 ; Y (d - A) DAIFTQSYRKVLAQLSARKLLQDILSR-NH2 ; L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6- [3 (2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl) - 1-oxopropyl] - L-lysinamide ; Acétate CJC-1295 ; CJC1295 avec DAC
    CAS : 863288-34-0
    MF : C159H258N46O45
    MW : 0
    EINECS :  
    Catégories de produit : Peptides

    Notre processus :
    Le processus de contrôle de qualité
    1) achat
    La recherche de marché complète, comprennent le prix des matières premières et de la représentation. À la source de fourniture à comprendre entièrement, et pour garantir entièrement la qualité de la fourniture des matières premières.

    2) Inspection
    Quatre étapes : échantillonnage, traitement préparatoire d'échantillon, mesure et informatique.

    3) Production
    a) chaque opérateur doit faire l'auto-inspection des producs et noter correspondants inspection.
    b) les inspecteurs à plein temps vérifient l'auto-inspection d'opérateur, et l'examen et signent dedans le disque correspondant. L'inspection à plein temps est responsable de l'inspection du produit fini, et note au produit fini entrants inspection.

    4) Avant la vente
    Le résultat d'essai peut être fourni avant la vente.
    On permet le tiers établissement de détection si vous n'êtes pas satisfait des résultats d'essai.

    Nos avantages :
    1. qualité :
    Notre société est une production professionnelle des intermédiaires d'hormone depuis de nombreuses années, nos produits ont exporté vers l'Allemagne, Espagne, R-U, Etats-Unis, Australie, Moyen-Orient, et ainsi de suite l'autre pays, et nous avons le retour très bon de nos clients, vous pouvons nous faire confiance.
    Et nous sommes l'usine, ainsi aucun problème pour que nous commandent la qualité.
    2. méthode de paiement : , TTT.
    3. service : Le meilleur service avec le service après-vente à tous les clients.
    4. la livraison :
    Ordre d'échantillon : Le paquet sera embarqué avec 3days après paiement. Nous pouvons l'envoyer par l'intermédiaire de, SME, HK aérons le courrier, le DHL ou l'othermethod. Nous avons une logistique professionnelle et stable, et nous pouvons fournir le paquet sans à-coup environ 3 à 5 jours.

    L'autre peptide notre approvisionnement de laboratoire :

    Produit Pureté CAS non.
    Chlorhydrate de glucagon 98% 16941-32-5
    Acétate de Gonadorelin 98% 34973-08-5
    Acétate de Goserelin 98% 145781-92-6
    Acétate (humain) de GRF 98% 83930-13-6
    Acétate de Hexarelin 98% 140703-51-1
    Acétate de Histrelin 98% 76712-82-8
    Acétate d'Icatibant 98% 30308-48-4
    Lanreotide 98% 108736-35-2
    Acétate de Lecirelin (Dalmarelin) 98% 61012-19-9
    Leuprolide 98% 74381-53-6
    Acétate de Leuprorelin 98% 53714-56-0
    Linaclotide Acatate 98% 851199-59-2
    Lixisenatide 98% 320367-13-3
    Lraglutide 98% 204656-20-2
    Acétate de Lysipressin 98% 50-57-7
    Acétate de Melanotan II 98% 121062-08-6
    MOG (35-55) 98% 163913-87-9
    Acétate de Nafarelin 98% 76932-56-4
    Acétate de Nesiritide (BNP-32) 98% 114471-18-0
    Octreotide 98% 79517-01-4
    Acétate d'Ornipressin 98% 3397-23-7
    Acétate d'oxytocine 98% 50-56-6
    Palmitoyl Pentapeptide 98% 214047-00-4
    Pexiganan 98% 147664-63-9
    Acétate de Pramlintide 98% 196078-30-5
    Acétate PT141 98% 32780-32-8
    Acétate saumoné de calcitonine 98% 47931-85-1
    Acétate de Secretin 98% 10813-74-8
    Acétate de Sermorelin 98% 86168-78-7
    Sincalide 98% 25126-32-3
    Acétate de Somatostatin 98% 38916-34-6
    Acétate de Splenopentin 98% 105184-37-0
    Acétate de Taltirelin 98% 103300-74-9
    Acétate de Teriparatide 98% 52232-67-4
    Acétate de Teriparatide 98% 52232-67-4
    Acétate de Terlipressin 98% 14636-12-5
    Acétate de Tetracosactide 98% 16960-16-0
    Thymalfasin 98% 62304-98-7
    Thymopentin 98% 69558-55-0
    Acétate de Thymosin α1 98% 14636-12-5
    Acétate de Thymosin β4 (TB-500) 98% 77591-33-4
    Acétate de Triptorelin 98% 57773-63-4
    Acétate de Vapreotide 98% 103222-11-3
    Acétate de Vasopressin 98% 9034-50-8
    Acétate de Ziconotide 98% 107452-89-1



    Peptides CJC-1295 de bâtiment de muscle sans DAC pour des Bodybuilders 0

    Politique de clients de VIP :
    Si votre montant total acquéreur à notre société par an pourrait atteindre 50 000 USD, au de fin d'année, nous pourrions employer 2%-5% du montant total pour envoyer les marchandises libres.

    Types de client qui ont eu plus d'appui :
    client 1.Potential
    (Avec le nombre de clients du marché de données d'achat +Clients et la quantité actuels de produits par mois à appliquer)

    groupe du client 2.Stable et ordre stable de quantité par mois
    (Avec des données d'achat complètes avec notre société à appliquer)

    utilisateurs 3.Regular personnels
    (Avec des données d'achat complètes avec notre société à appliquer)

    4.Clients qui ont des fonds et ont le plan pour augmenter le marché
    (Avec le nombre de clients du marché de données d'achat +Clients et la quantité actuels de produits par mois à appliquer)
    ** Vrai marché actuel de Data+Future (basé sur le courant)

    Passion Technology Development Limited

    Personne à contacter: Qin

    Envoyez votre demande directement à nous (0 / 3000)

    Autres Produits
    Demande de soumission

    E-Mail | Sitemap

    Privacy Policy Chine Bon Qualité Peptides injectables Fournisseur. © 2018 - 2021 All Rights Reserved.